PDB entry 1jfp

View 1jfp on RCSB PDB site
Description: Structure of bovine rhodopsin (dark adapted)
Deposited on 2001-06-21, released 2001-10-05
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-05, with a file datestamp of 2001-10-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jfpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfpA (A:)
    laaymfllimlgfpinfltlyvtvqhkklrtplnyillnlavadlfmvfggftttlytsl
    hgyfvfgptgcnlegffatlggeialwslvvlaieryvvvckpmsnfrfgenhaimgvaf
    twvmalacaapplvgwsryipegmqcscgidyytpheetnnesfviymfvvhfiiplivi
    ffcygqlvftvkeaaaqqqesattqkaekevtrmviimviaflicwlpyagvafyifthq
    gsdfgpifmtipaffaktsavynpviyimmnkqfrncmvttlccgknplgddeasttvsk
    tetsqvapa