PDB entry 1jfk

View 1jfk on RCSB PDB site
Description: minimum energy representative structure of a calcium bound ef-hand protein from entamoeba histolytica
Class: metal binding protein
Keywords: ef-hand, helix-loop-helix, calcium binding protein, entamoeba histolytica, metal binding protein
Deposited on 2001-06-21, released 2001-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium-binding protein
    Species: Entamoeba histolytica [TaxId:5759]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38505 (0-133)
      • conflict (130)
    Domains in SCOPe 2.08: d1jfka_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfkA (A:)
    maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefak
    fygsiqgqdlsddkiglkvlyklmdvdgdgkltkeevtsffkkhgiekvaeqvmkadang
    dgyitleeflefsl