PDB entry 1jfj

View 1jfj on RCSB PDB site
Description: nmr solution structure of an ef-hand calcium binding protein from entamoeba histolytica
Class: metal binding protein
Keywords: ef-hand, helix-loop-helix, calcium-binding protein, metal binding protein
Deposited on 2001-06-20, released 2001-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calcium-binding protein
  Species: Entamoeba histolytica [TaxId:5759]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38505 (0-133)
    • conflict (130)
  Domains in SCOPe 2.06: d1jfja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jfjA (A:)
  maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefak
  fygsiqgqdlsddkiglkvlyklmdvdgdgkltkeevtsffkkhgiekvaeqvmkadang
  dgyitleeflefsl