PDB entry 1jfh

View 1jfh on RCSB PDB site
Description: structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution
Deposited on 1997-09-19, released 1998-12-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.16
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfh_ (-)
    eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenvvvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgepfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl