PDB entry 1jfe

View 1jfe on RCSB PDB site
Description: Crystal structure of native chicken fibrinogen with two different bound ligands
Deposited on 2001-06-20, released 2001-12-05
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.227
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfeA (A:)
    ckyeknwpicvdddwgtkcpsgcrmqgiiddtdqnysqridnirqqladsqnkyktsnrv
    ivetinilkpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvve
    mkrlevdidikirackgscarsfdyqvdkegydniqkhltqassidmhpdfqtttlstlk
    mrplkdsnvpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfeB (B:)
    pdaggckhpldelgvlcptgcelqttllkqektvkpvlrdlkdrvakfsdtsttmyqyvn
    midnklvktqkqrkdndiilseyntemelhynyikdnldnnipsslrvlravidslhkki
    qklenaiatqtdycrspcvascnipvvsgrecediyrkggetsemyiiqpdpfttpyrvy
    cdmetdnggwtliqnrqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgndkis
    qltkigptkvliemedwngdkvsalyggftihnegnkyqlsvsnykgnagnalmegasql
    ygenrtmtihngmyfstydrdndgwlttdprkqcskedgggwwynrchaanpngryywgg
    tyswdmakhgtddgivwmnwkgswysmkkmsmkikpyfpd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfeC (C:)
    nccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyliqhikt
    iypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnkitqlkq
    kiaqleshcqepckdtaeiqettgrdcqdiankgarksglyfikpqkakqsflvyceidt
    ygngwtvlqrrldgsedfrrnwvqykegfghlspddttefwlgnekihlittqstlpyal
    rieledwsgkkgtadyavfkvgteedkyrltyayfiggeagdafdgfnfgddpsdksyty
    hngmrfstfdndndnfegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgtnsydng
    iiwatwrdrwysmkkttmkiipfnrls
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfeD (D:)
    ckyeknwpicvdddwgtkcpsgcrmqgiiddtdqnysqridnirqqladsqnkyktsnrv
    ivetinilkpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvve
    mkrlevdidikirackgscarsfdyqvdkegydniqkhltqassidmhpdfqtttlstlk
    mrplkdsnvpehf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfeE (E:)
    pdaggckhpldelgvlcptgcelqttllkqektvkpvlrdlkdrvakfsdtsttmyqyvn
    midnklvktqkqrkdndiilseyntemelhynyikdnldnnipsslrvlravidslhkki
    qklenaiatqtdycrspcvascnipvvsgrecediyrkggetsemyiiqpdpfttpyrvy
    cdmetdnggwtliqnrqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgndkis
    qltkigptkvliemedwngdkvsalyggftihnegnkyqlsvsnykgnagnalmegasql
    ygenrtmtihngmyfstydrdndgwlttdprkqcskedgggwwynrchaanpngryywgg
    tyswdmakhgtddgivwmnwkgswysmkkmsmkikpyfp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfeF (F:)
    nccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyliqhikt
    iypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnkitqlkq
    kiaqleshcqepckdtaeiqettgrdcqdiankgarksglyfikpqkakqsflvyceidt
    ygngwtvlqrrldgsedfrrnwvqykegfghlspddttefwlgnekihlittqstlpyal
    rieledwsgkkgtadyavfkvgteedkyrltyayfiggeagdafdgfnfgddpsdksyty
    hngmrfstfdndndnfegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgtnsydng
    iiwatwrdrwysmkkttmkiipfnrls