PDB entry 1jf9

View 1jf9 on RCSB PDB site
Description: crystal structure of selenocysteine lyase
Deposited on 2001-06-20, released 2001-07-04
The last revision prior to the SCOP 1.71 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1jf9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jf9A (A:)
    gsmifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgi
    htlsaqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniii
    sqmehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlg
    tenplaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyv
    keallqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalg
    lnniaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiav
    rtghhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jf9A (A:)
    ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtl
    saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
    ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
    plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
    llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
    iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
    hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg