PDB entry 1jf9

View 1jf9 on RCSB PDB site
Description: Crystal Structure of selenocysteine lyase
Class: lyase
Keywords: NIFS, SELENOCYSTEINE, CYSTEINE, PURSULFIDE, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, LYASE
Deposited on 2001-06-20, released 2001-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: selenocysteine lyase
    Species: Escherichia coli [TaxId:562]
    Gene: NIFS/CSDB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jf9a_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jf9A (A:)
    gsmifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgi
    htlsaqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniii
    sqmehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlg
    tenplaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyv
    keallqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalg
    lnniaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiav
    rtghhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jf9A (A:)
    ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtl
    saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
    ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
    plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
    llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
    iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
    hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg