PDB entry 1jf3

View 1jf3 on RCSB PDB site
Description: Crystal Structure Of Component III Glycera Dibranchiata Monomeric Hemoglobin
Class: oxygen storage/transport
Keywords: Glycera, monomer hemoglobin
Deposited on 2001-06-20, released 2002-06-20
The last revision prior to the SCOP 1.75 freeze date was dated 2002-09-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.189
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monomer hemoglobin component III
    Species: Glycera dibranchiata
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jf3a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jf3A (A:)
    glsaaqrqvvastwkdiagadngagvgkeclskfisahpemaavfgfsgasdpgvaelga
    kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
    kmnaaakdawaaaygdisgalisglqs