PDB entry 1jf0

View 1jf0 on RCSB PDB site
Description: the crystal structure of obelin from obelia geniculata at 1.82 a resolution
Deposited on 2001-06-19, released 2001-07-11
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.212
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1jf0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jf0A (A:)
    kyavklqtdfdnpkwikrhkfmfdyldingngqitldeivskasddicknlgatpaqtqr
    hqdcveaffrgcgleygketkfpeflegwknlanadlakwarneptlirewgdavfdifd
    kdgsgtitldewkaygrisgispseedcektfqhcdldnsgeldvdemtrqhlgfwytld
    peadglygngvp