PDB entry 1jf0

View 1jf0 on RCSB PDB site
Description: The Crystal Structure of Obelin from Obelia geniculata at 1.82 A Resolution
Class: luminescent protein
Keywords: bioluminescence, calcium-regulated photoprotein, obelin, obelia, hydroid, LUMINESCENT PROTEIN
Deposited on 2001-06-19, released 2001-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: obelin
    Species: Obelia longissima [TaxId:32570]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jf0a_
  • Heterogens: CZH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jf0A (A:)
    maskyavklqtdfdnpkwikrhkfmfdyldingngqitldeivskasddicknlgatpaq
    tqrhqdcveaffrgcgleygketkfpeflegwknlanadlakwarneptlirewgdavfd
    ifdkdgsgtitldewkaygrisgispseedcektfqhcdldnsgeldvdemtrqhlgfwy
    tldpeadglygngvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jf0A (A:)
    kyavklqtdfdnpkwikrhkfmfdyldingngqitldeivskasddicknlgatpaqtqr
    hqdcveaffrgcgleygketkfpeflegwknlanadlakwarneptlirewgdavfdifd
    kdgsgtitldewkaygrisgispseedcektfqhcdldnsgeldvdemtrqhlgfwytld
    peadglygngvp