PDB entry 1jey

View 1jey on RCSB PDB site
Description: crystal structure of the ku heterodimer bound to dna
Deposited on 2001-06-19, released 2001-08-10
The last revision prior to the SCOP 1.65 freeze date was dated 2002-01-30, with a file datestamp of 2002-01-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1jeya_
  • Chain 'B':
    Domains in SCOP 1.65: d1jeyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jeyA (A:)
    msgwesyyktegdeeaeeeqeenleasgdykysgrdsliflvdaskamfesqsedeltpf
    dmsiqciqsvyiskiissdrdllavvfygtekdknsvnfkniyvlqeldnpgakrileld
    qfkgqqgqkrfqdmmghgsdyslsevlwvcanlfsdvqfkmshkrimlftnednphgnds
    akasrartkagdlrdtgifldlmhlkkpggfdislfyrdiisiaededlrvhfeesskle
    dllrkvraketrkralsrlklklnkdivisvgiynlvqkalkpppiklyretnepvktkt
    rtfntstgglllpsdtkrsqiygsrqiilekeeteelkrfddpglmlmgfkplvllkkhh
    ylrpslfvypeeslvigsstlfsallikclekevaalcrytprrnippyfvalvpqeeel
    ddqkiqvtppgfqlvflpfaddkrkmpftekimatpeqvgkmkaiveklrftyrsdsfen
    pvlqqhfrnlealaldlmepeqavdltlpkveamnkrlgslvdefkelvyppdynpegkv
    tkrkhdnegsgskrpkveyseeelkthiskgtlgkftvpmlkeacrayglksglkkqell
    ealtkhfqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jeyA (A:)
    grdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekd
    knsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanl
    fsdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdi
    slfyrdiisvhfeesskledllrkvraketrkralsrlklklnkdivisvgiynlvqkal
    kpppiklyretnepvktktrtfntstgglllpsdtkrsqiygsrqiilekeeteelkrfd
    dpglmlmgfkplvllkkhhylrpslfvypeeslvigsstlfsallikclekevaalcryt
    prrnippyfvalvpqeeelddqkiqvtppgfqlvflpfaddkrkmpftekimatpeqvgk
    mkaiveklrftyrsdsfenpvlqqhfrnlealaldlmepeqavdltlpkveamnkrlgsl
    vdefkelvyppdy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jeyB (B:)
    mvrsgnkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfg
    tdgtdnplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqh
    etigkkfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslgkedgsgdrgd
    gpfrlgghgpsfplkgiteqqkegleivkmvmislegedgldeiysfseslrklcvfkki
    erhsihwpcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvyclndd
    detevlkediiqgfrygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnq
    vlkvfaarddeaaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclv
    yvqlpfmedlrqymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfptt
    kipnprfqrlfqcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfpli
    eakkkdqvtaqeifqdnhedgptak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jeyB (B:)
    nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
    nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
    kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslggpfrlgghgpsfplk
    giteqqkegleivkmvmislegedgldeiysfseslrklcvfkkierhsihwpcrltigs
    nlsiriaayksilqervkktwtvvdaktlkkediqketvyclndddetevlkediiqgfr
    ygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkvfaarddeaaav
    alsslihalddldmvaivryaydkranpqvgvafphikhnyeclvyvqlpfmedlrqymf
    sslknskkyapteaqlnavdalidsmslakkdektdtledlfpttkipnprfqrlfqcll
    hralhpreplppiqqhiwnmlnppaevttksqiplskiktlfplieakkk