PDB entry 1jeq

View 1jeq on RCSB PDB site
Description: crystal structure of the ku heterodimer
Deposited on 2001-06-18, released 2001-08-15
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-15, with a file datestamp of 2001-08-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1jeqa_
  • Chain 'B':
    Domains in SCOP 1.57: d1jeqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jeqA (A:)
    rdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekdk
    nsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanlf
    sdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdis
    lfyrdiisiaededlrvhfeesskledllrkvraketrkralsrlklklnkdivisvgiy
    nlvqkalkpppiklyretnepvktktrtfntstgglllpsdtkrsqiygsrqiilekeet
    eelkrfddpglmlmgfkplvllkkhhylrpslfvypeeslvigsstlfsallikclekev
    aalcrytprrnippyfvalvpqeeelddqkiqvtppgfqlvflpfaddkrkmpftekima
    tpeqvgkmkaiveklrftyrsdsfenpvlqqhfrnlealaldlmepeqavdltlpkveam
    nkrlgslvdefkelvyppdynpegkvtkrkhdnegsgskrpkveyseeelkthiskgtlg
    kftvpmlkeacrayglksglkkqellealtkhfqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jeqA (A:)
    rdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekdk
    nsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanlf
    sdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdis
    lfyrdiisivhfeesskledllrkvraketrkralsrlklklnkdivisvgiynlvqkal
    kpppiklyretnepvktktrtfntstgglllpsdtkrsqiygsrqiilekeeteelkrfd
    dpglmlmgfkplvllkkhhylrpslfvypeeslvigsstlfsallikclekevaalcryt
    prrnippyfvalvpqeeelddqkiqvtppgfqlvflpfaddkrkmpftekimatpeqvgk
    mkaiveklrftyrsdsfenpvlqqhfrnlealaldlmepeqavdltlpkveamnkrlgsl
    vdefkelvyppdynpegyseeelkthiskgtlgkftvpmlkeacrayglksglkkqelle
    altkhfqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jeqB (B:)
    nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
    nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
    kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslgkedgsgdrgdgpfrl
    gghgpsfplkgiteqqkegleivkmvmislegedgldeiysfseslrklcvfkkierhsi
    hwpcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvyclndddetev
    lkediiqgfrygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkvf
    aarddeaaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclvyvqlp
    fmedlrqymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfpttkipnp
    rfqrlfqcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfpliea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jeqB (B:)
    nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
    nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
    kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslpfrlgghgfplkgite
    qqkegleivkmvmislegedgldeiysfseslrklcvfkkierhsihwpcrltigsnlsi
    riaayksilqervkktwtvvdaktlkkediqketvyclndddetevlkediiqgfrygsd
    ivpfdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkvfaarddeaaavalsslih
    alddldmvaivryaydkranpqvgvafphikhnyeclvyvqlpfmedlrqymfsslknsk
    kyapteaqlnavdalidsmslakkdektdtledlfpttkipnprfqrlfqcllhralhpr
    eplppiqqhiwnmlnppaevttksqiplskiktlfpliea