PDB entry 1jef

View 1jef on RCSB PDB site
Description: turkey lysozyme complex with (glcnac)3
Class: hydrolase
Keywords: enzyme, hydrolase, inhibitor complex, glycosidase, bacteriolytic enzyme
Deposited on 1997-04-23, released 1997-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jefa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jefA (A:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl