PDB entry 1jed

View 1jed on RCSB PDB site
Description: Crystal Structure of ATP Sulfurylase in complex with ADP
Class: transferase
Keywords: alpha-beta protein, beta-barrel, Rossmann-fold, inhibitor complex, ADP, TRANSFERASE
Deposited on 2001-06-17, released 2001-11-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.192
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfate adenylyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1jeda1, d1jeda2, d1jeda3
  • Chain 'B':
    Compound: sulfate adenylyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1jedb1, d1jedb2, d1jedb3
  • Heterogens: CD, CA, NA, MG, ADP, TRS, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jedA (A:)
    paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
    endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
    kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlrl
    efqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvrv
    yqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknskg
    vdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgtel
    rrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstflq
    fgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldtsssa
    diqlesadepishivqkvvlfledngffvf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jedB (B:)
    paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
    endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
    kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlrl
    efqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvrv
    yqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknskg
    vdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgtel
    rrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstflq
    fgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldtsssa
    diqlesadepishivqkvvlfledngffvf