PDB entry 1jec

View 1jec on RCSB PDB site
Description: Crystal Structure of ATP Sulfurylase in complex with thiosulfate
Class: transferase
Keywords: alpha-beta protein, beta-barrel, Rossmann-fold, inhibitor complex, thiosulfate, TRANSFERASE
Deposited on 2001-06-17, released 2001-11-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.178
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfate adenylyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1jeca1, d1jeca2, d1jeca3
  • Heterogens: CD, CA, MG, NA, SO4, THJ, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jecA (A:)
    paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
    endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
    kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlrl
    efqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvrv
    yqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknskg
    vdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgtel
    rrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstflq
    fgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldtsssa
    diqlesadepishivqkvvlfledngffvf