PDB entry 1jdl

View 1jdl on RCSB PDB site
Description: structure of cytochrome c2 from rhodospirillum centenum
Deposited on 2001-06-14, released 2001-11-07
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-07, with a file datestamp of 2001-11-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jdla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jdlA (A:)
gdpakgeavfkkcmachrvgpdaknlvgpaltgvidrqagtapgfnysainhaageaglh
wtpeniiaylpdpnaflrkfladaghaeqakgstkmvfklpdeqerkdvvaylkqfsp