PDB entry 1jde

View 1jde on RCSB PDB site
Description: k22a mutant of pyruvate, phosphate dikinase
Deposited on 2001-06-13, released 2001-11-28
The last revision prior to the SCOP 1.71 freeze date was dated 2001-11-28, with a file datestamp of 2001-11-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.193
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jdeA (A:)
    akwvykfeegnasmrnllggagcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkiykgdietqeasvsgsferimvwadkfrtlkvrtnad
    tpedtlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgd
    fkamykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpm
    mghrgcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvv
    vevaeqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrdd
    agkfldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssv
    efchkvglnyvscspfrvpiarlaaaqaalnnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jdeA (A:)
    akwvykfeegnasmrnllggagcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkietqeasvsgsferimvwadkfrtlkvrtnadtpedt
    lnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgdfkamy
    kalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpmmghrg
    crlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvvvevae
    qvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrddagkfl
    dsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssvefchk
    vglnyvscspfrvpiarlaaaqaalnnk