PDB entry 1jcv

View 1jcv on RCSB PDB site
Description: reduced bridge-broken yeast cu/zn superoxide dismutase low temperature (-180c) structure
Class: oxidoreductase (superoxide acceptor)
Keywords: oxidoreductase, oxidoreductase (superoxide acceptor)
Deposited on 1995-12-07, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.19
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cu/zn superoxide dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jcva_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jcvA (A:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn