PDB entry 1jck

View 1jck on RCSB PDB site
Description: T-cell receptor beta chain complexed with sec3 superantigen
Class: complex (toxin/receptor)
Keywords: T-cell, receptor, transmembrane, glycoprotein, signal, enterotoxin, toxin, superantigen, complex (toxin/receptor)
Deposited on 1996-10-22, released 1997-11-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.238
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14.3.d t cell antigen receptor
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB41230 (0-237)
      • engineered (21)
      • engineered (70)
      • insertion (95-97)
      • engineered (116)
    Domains in SCOPe 2.02: d1jcka1, d1jcka2
  • Chain 'B':
    Compound: staphylococcal enterotoxin c3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5 (0-238)
      • conflict (53)
      • conflict (58)
      • conflict (74)
      • conflict (105)
      • conflict (132)
      • conflict (190)
      • conflict (215)
      • conflict (217)
      • conflict (221)
    Domains in SCOPe 2.02: d1jckb1, d1jckb2
  • Chain 'C':
    Compound: 14.3.d t cell antigen receptor
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAB41230 (0-237)
      • engineered (21)
      • engineered (70)
      • insertion (95-97)
      • engineered (116)
    Domains in SCOPe 2.02: d1jckc1, d1jckc2
  • Chain 'D':
    Compound: staphylococcal enterotoxin c3
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L5 (0-238)
      • conflict (53)
      • conflict (58)
      • conflict (74)
      • conflict (105)
      • conflict (132)
      • conflict (190)
      • conflict (215)
      • conflict (217)
      • conflict (221)
    Domains in SCOPe 2.02: d1jckd1, d1jckd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jckA (A:)
    avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvledlrqvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jckB (B:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynindkklnn
    ydkvktellnedlankykdevvdvygsnyyvncyfsskdnvgkvtsgktcmyggitkheg
    nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfiesngntfwydmmpapgdkfdqskylmiykdnkmvdsksvkievhlttkng
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jckC (C:)
    avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvledlrqvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrad
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jckD (D:)
    esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynindkklnn
    ydkvktellnedlankykdevvdvygsnyyvncyfsskdnvgkvtsgktcmyggitkheg
    nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfiesngntfwydmmpapgdkfdqskylmiykdnkmvdsksvkievhlttkng