PDB entry 1jbj

View 1jbj on RCSB PDB site
Description: CD3 Epsilon and gamma Ectodomain Fragment Complex in Single-Chain Construct
Deposited on 2001-06-05, released 2001-12-05
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jbjA (A:)
    ddaenieykvsisgtsveltcpldsdenlkwekngqelpqkhdkhlvlqdfsevedsgyy
    vcytpasnkntylylkarvgsaddakkdaakkddakkddakkdgsqtnkaknlvqvdgsr
    gdgsvlltcgltdktikwlkdgsiisplnatkntwnlgnnakdprgtyqcqgaketsnpl
    qvyyrm