PDB entry 1jba

View 1jba on RCSB PDB site
Description: unmyristoylated gcap-2 with three calcium ions bound
Deposited on 1999-04-03, released 1999-12-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-21, with a file datestamp of 2000-04-21.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1jbaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jbaA (A:)
    gqqfsweeaeengavgaadaaqlqewykkfleecpsgtlfmhefkrffkvpdneeatqyv
    eamfrafdtngdntidfleyvaalnlvlrgtlehklkwtfkiydkdrngcidrqelldiv
    esiyklkkacsveveaeqqgklltpeevvdrifllvdengdgqlslnefvegarrdkwvm
    kmlqmdlnp