PDB entry 1jba

View 1jba on RCSB PDB site
Description: unmyristoylated gcap-2 with three calcium ions bound
Class: lyase
Keywords: ef-hand, calcium-binding protein, guanylyl cyclase regulation, lyase
Deposited on 1999-04-03, released 1999-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (guanylate cyclase activating protein 2)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jbaa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jbaA (A:)
    mgqqfsweeaeengavgaadaaqlqewykkfleecpsgtlfmhefkrffkvpdneeatqy
    veamfrafdtngdntidfleyvaalnlvlrgtlehklkwtfkiydkdrngcidrqelldi
    vesiyklkkacsveveaeqqgklltpeevvdrifllvdengdgqlslnefvegarrdkwv
    mkmlqmdlnpsswisqqrrksamf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jbaA (A:)
    gqqfsweeaeengavgaadaaqlqewykkfleecpsgtlfmhefkrffkvpdneeatqyv
    eamfrafdtngdntidfleyvaalnlvlrgtlehklkwtfkiydkdrngcidrqelldiv
    esiyklkkacsveveaeqqgklltpeevvdrifllvdengdgqlslnefvegarrdkwvm
    kmlqmdlnp