PDB entry 1jb9

View 1jb9 on RCSB PDB site
Description: crystal structure of the ferredoxin:nadp+ reductase from maize root at 1.7 angstroms
Deposited on 2001-06-03, released 2001-07-04
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-12, with a file datestamp of 2001-12-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jb9A (A:)
    srskvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvp
    ywegqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgk
    edpskngvcsnflcnskpgdkiqltgpsgkimllpeedpnathimiatgtgvapfrgylr
    rmfmedvpnyrfgglawlflgvansdsllydeeftsylkqypdnfrydkalsreqknrsg
    gkmyvqdkieeysdeifklldggahiyfcglkgmmpgiqdtlkkvaerrgeswdqklaql
    kknkqwhvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jb9A (A:)
    srskvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvp
    ywegqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgk
    edpskngvcsnflcnskpgdkiqltgpsgkimllpeedpnathimiatgtgvapfrgylr
    rmfmedvpnyrfgglawlflgvansdsllydeeftsylkqypdnfrydkalsreqkgkmy
    vqdkieeysdeifklldggahiyfcglkgmmpgiqdtlkkvaerrgeswdqklaqlkknk
    qwhvevy