PDB entry 1jap

View 1jap on RCSB PDB site
Description: complex of pro-leu-gly-hydroxylamine with the catalytic domain of matrix metallo proteinase-8 (met80 form)
Class: complex (metalloprotease/inhibitor)
Keywords: metalloprotease, zinc-endopeptidase, metzincins
Deposited on 1996-03-11, released 1996-07-11
The last revision prior to the SCOP 1.75 freeze date was dated 1996-07-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: matrix metallo proteinase-8 (met80 form)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1japa_
  • Chain 'I':
    Compound: pro-leu-gly-hydroxylamine
  • Heterogens: CA, ZN, HOA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1japA (A:)
mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg

    Sequence, based on observed residues (ATOM records): (download) 
    >1japA (A:)
pkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyqr
dhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslgl
ahssdpgalmypnyafretsnyslpqddidgiqaiyg

  • Chain 'I':
    No sequence available.