PDB entry 1jaj

View 1jaj on RCSB PDB site
Description: Solution Structure of DNA Polymerase X from the African Swine Fever Virus
Class: viral protein
Keywords: Cis peptide, Viral protein
Deposited on 2001-05-30, released 2001-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase beta-like protein
    Species: African swine fever virus [TaxId:10498]
    Gene: O174L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jaja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jajA (A:)
mltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdlliivpekk
llkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhftgpv
syliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl