PDB entry 1j99

View 1j99 on RCSB PDB site
Description: crystal structure of human dehydroepiandrosterone sulfotransferase in complex with substrate
Deposited on 2001-05-24, released 2002-05-24
The last revision prior to the SCOP 1.67 freeze date was dated 2002-06-19, with a file datestamp of 2002-06-19.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.231
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1j99a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j99A (A:)
    giprnsrvdsddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlae
    ilclmhskgdakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffss
    kakviylmrnprdvlvsgyffwknmkflkkpksweeyfewfcqgtvlygswfdhihgwmp
    mreeknflllsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnys
    llsvdyvvdktqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j99A (A:)
    sddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskg
    dakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmr
    nprdvlvsgyffwknmkflkkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfll
    lsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvd
    ktqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe