PDB entry 1j99

View 1j99 on RCSB PDB site
Description: crystal structure of human dehydroepiandrosterone sulfotransferase in complex with substrate
Class: transferase
Keywords: Dehydroepiandosterone, Sulfotransferase, DHEA
Deposited on 2001-05-24, released 2002-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.231
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol sulfotransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06520 (9-292)
      • see remark 999 (147)
      • see remark 999 (250)
    Domains in SCOPe 2.08: d1j99a_
  • Heterogens: IOD, HGI, AND, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j99A (A:)
    giprnsrvdsddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlae
    ilclmhskgdakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffss
    kakviylmrnprdvlvsgyffwknmkflkkpksweeyfewfcqgtvlygswfdhihgwmp
    mreeknflllsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnys
    llsvdyvvdktqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j99A (A:)
    sddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskg
    dakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmr
    nprdvlvsgyffwknmkflkkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfll
    lsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvd
    ktqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe