PDB entry 1j86

View 1j86 on RCSB PDB site
Description:
Deposited on 2001-05-20, released 2001-08-29
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-29, with a file datestamp of 2001-08-29.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.245
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1j86a1, d1j86a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1j86b1, d1j86b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j86A (A:)
    vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
    edsgeykcqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviy
    ykdgealkywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvikapr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j86B (B:)
    vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
    edsgeykcqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviy
    ykdgealkywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvikap