PDB entry 1j7s

View 1j7s on RCSB PDB site
Description: Crystal Structure of deoxy HbalphaYQ, a mutant of HbA
Class: oxygen storage/transport
Keywords: globin
Deposited on 2001-05-18, released 2002-02-27
The last revision prior to the SCOP 1.73 freeze date was dated 2002-02-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.16
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin
    Species: HOMO SAPIENS
    Gene: HBA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • engineered (0)
      • engineered (28)
      • engineered (57)
    Domains in SCOP 1.73: d1j7sa_
  • Chain 'B':
    Compound: hemoglobin
    Species: HOMO SAPIENS
    Gene: HBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered (0)
    Domains in SCOP 1.73: d1j7sb_
  • Chain 'C':
    Compound: hemoglobin
    Species: HOMO SAPIENS
    Gene: HBA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • engineered (0)
      • engineered (28)
      • engineered (57)
    Domains in SCOP 1.73: d1j7sc_
  • Chain 'D':
    Compound: hemoglobin
    Species: HOMO SAPIENS
    Gene: HBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered (0)
    Domains in SCOP 1.73: d1j7sd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7sA (A:)
    mlspadktnvkaawgkvgahageygaeayermflsfpttktyfphfdlshgsaqvkgqgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7sB (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7sC (C:)
    mlspadktnvkaawgkvgahageygaeayermflsfpttktyfphfdlshgsaqvkgqgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7sD (D:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh