PDB entry 1j7p

View 1j7p on RCSB PDB site
Description: Solution structure of Calcium calmodulin C-terminal domain
Class: metal binding protein
Keywords: EF hands, helix bundle, calcium, dipolar coupling, METAL BINDING PROTEIN
Deposited on 2001-05-17, released 2001-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62158 (0-66)
  Domains in SCOPe 2.06: d1j7pa_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j7pA (A:)
  eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef
  vqmmtak