PDB entry 1j7i

View 1j7i on RCSB PDB site
Description: Crystal Structure of 3',5"-Aminoglycoside Phosphotransferase Type IIIa Apoenzyme
Deposited on 2001-05-16, released 2001-08-08
The last revision prior to the SCOP 1.63 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.219
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1j7ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7iA (A:)
    rispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverekdmm
    lwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirlfhs
    idisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpeeel
    vfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelffdl
    lgikpdwekikyyilldelf