PDB entry 1j7f

View 1j7f on RCSB PDB site
Description: subunit c oligomer of the e.coli atp synthase
Deposited on 2001-05-16, released 2001-06-20
Made obsolete on 2002-08-09

The last revision prior to the SCOP 1.59 freeze date was dated 2001-06-20, with a file datestamp of 2001-06-20.
Experiment type: THEORY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -5.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1j7fa_
  • Chain 'B':
    Domains in SCOP 1.59: d1j7fb_
  • Chain 'C':
    Domains in SCOP 1.59: d1j7fc_
  • Chain 'D':
    Domains in SCOP 1.59: d1j7fd_
  • Chain 'E':
    Domains in SCOP 1.59: d1j7fe_
  • Chain 'F':
    Domains in SCOP 1.59: d1j7ff_
  • Chain 'G':
    Domains in SCOP 1.59: d1j7fg_
  • Chain 'H':
    Domains in SCOP 1.59: d1j7fh_
  • Chain 'I':
    Domains in SCOP 1.59: d1j7fi_
  • Chain 'J':
    Domains in SCOP 1.59: d1j7fj_
  • Chain 'K':
    Domains in SCOP 1.59: d1j7fk_
  • Chain 'L':
    Domains in SCOP 1.59: d1j7fl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fA (A:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fB (B:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fC (C:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fD (D:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fE (E:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fF (F:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fG (G:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fH (H:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fI (I:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fJ (J:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fK (K:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7fL (L:)
    menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
    daipmiavglglyvmfava