PDB entry 1j7c

View 1j7c on RCSB PDB site
Description: structure of the anabaena ferredoxin mutant e95k
Class: electron transport
Keywords: electron transport, iron-sulfur, ferredoxin
Deposited on 2001-05-16, released 2001-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin I
    Species: Nostoc sp. PCC [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3C7 (0-97)
      • engineered (94)
    Domains in SCOPe 2.07: d1j7ca_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7cA (A:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkekdly