PDB entry 1j75

View 1j75 on RCSB PDB site
Description: Crystal Structure of the DNA-Binding Domain Zalpha of DLM-1 Bound to Z-DNA
Class: immune system/DNA
Keywords: protein-z-DNA complex, immune system-DNA complex
Deposited on 2001-05-15, released 2001-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.22152
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor Stroma and Activated Macrophage Protein DLM-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1j75a_
  • Chain 'B':
    Compound: 5'-d(*tp*cp*gp*cp*gp*cp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1j75A (A:)
gshmlstgdnleqkilqvlsddggpvkigqlvkkcqvpkktlnqvlyrlkkedrvsspep
atwsigg

    Sequence, based on observed residues (ATOM records): (download) 
    >1j75A (A:)
nleqkilqvlsddggpvkigqlvkkcqvpkktlnqvlyrlkkedrvsspepatwsig

  • Chain 'B':
    No sequence available.