PDB entry 1j70

View 1j70 on RCSB PDB site
Description: crystal structure of yeast atp sulfurylase
Deposited on 2001-05-15, released 2003-06-17
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j70A (A:)
    gshmpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfsplt
    gflnendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtv
    qdvykpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpa
    qlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhht
    rvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgk
    nskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnis
    gtelrrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsialls
    tflqfgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldt
    sssadiqlesadepishivqkvvlfledngffvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j70A (A:)
    hmpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgf
    lnendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqd
    vykpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaql
    rlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrv
    rvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgkns
    kgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgt
    elrrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstf
    lqfgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldtss
    sadiqlesadepishivqkvvlfledngffvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j70B (B:)
    gshmpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfsplt
    gflnendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtv
    qdvykpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpa
    qlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhht
    rvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgk
    nskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnis
    gtelrrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsialls
    tflqfgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldt
    sssadiqlesadepishivqkvvlfledngffvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j70B (B:)
    hmpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgf
    lnendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqd
    vykpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaql
    rlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrv
    rvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgkns
    kgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgt
    elrrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstf
    lqfgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldtss
    sadiqlesadepishivqkvvlfledngffvf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j70C (C:)
    gshmpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfsplt
    gflnendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtv
    qdvykpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpa
    qlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhht
    rvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgk
    nskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnis
    gtelrrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsialls
    tflqfgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldt
    sssadiqlesadepishivqkvvlfledngffvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j70C (C:)
    mpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfl
    nendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdv
    ykpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlr
    lefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvr
    vyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknsk
    gvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgte
    lrrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstfl
    qfgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldtsss
    adiqlesadepishivqkvvlfledngffvf