PDB entry 1j5q

View 1j5q on RCSB PDB site
Description: the structure and evolution of the major capsid protein of a large, lipid-containing, dna virus.
Deposited on 2002-06-27, released 2002-11-20
Made obsolete by 5tiq on 2017-12-20

The last revision prior to the SCOP 1.65 freeze date was dated 2002-11-27, with a file datestamp of 2002-11-27.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.269
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j5qA (A:)
    magglsqlvaygaqdvyltgnpqitffktvyrrytnfaiesiqqtingsvgfgnkvstqi
    srngdlitdivvefvltkggnggttyypaeellqdveleiggqridkhyndwfrtydalf
    rmnddrynyrrmtdwvnnelvgaqkrfyvplifffnqtpglalplialqyhevklyftla
    sqvqgvnyngssaiagaaqptmsvwvdyifldtqertrfaqlpheylieqlqftgsetat
    psattqasqnirlnfnhptkylawnfnnptnygqytalanipgacsgagtaaatvttpdy
    gntgtyneqlavldsakiqlngqdrfatrkgsyfnkvqpyqsiggvtpagvylysfalkp
    agrqpsgtcnfsridnatlsltyktcsidatspaavlgntetvtantatlltalniyakn
    ynvlrimsgmgglayan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5qA (A:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j5qB (B:)
    magglsqlvaygaqdvyltgnpqitffktvyrrytnfaiesiqqtingsvgfgnkvstqi
    srngdlitdivvefvltkggnggttyypaeellqdveleiggqridkhyndwfrtydalf
    rmnddrynyrrmtdwvnnelvgaqkrfyvplifffnqtpglalplialqyhevklyftla
    sqvqgvnyngssaiagaaqptmsvwvdyifldtqertrfaqlpheylieqlqftgsetat
    psattqasqnirlnfnhptkylawnfnnptnygqytalanipgacsgagtaaatvttpdy
    gntgtyneqlavldsakiqlngqdrfatrkgsyfnkvqpyqsiggvtpagvylysfalkp
    agrqpsgtcnfsridnatlsltyktcsidatspaavlgntetvtantatlltalniyakn
    ynvlrimsgmgglayan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5qB (B:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan