PDB entry 1j52

View 1j52 on RCSB PDB site
Description: Recombinant sperm whale myoglobin in the presence of 7atm xenon
Class: oxygen storage/transport
Keywords: oxygen transport, heme, muscle protein, xenon, internal cavities
Deposited on 2002-01-08, released 2003-11-11
The last revision prior to the SCOP 1.73 freeze date was dated 2003-11-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.155
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • initiating met (0)
      • engineered (122)
    Domains in SCOP 1.73: d1j52a_
  • Heterogens: SO4, HEM, XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j52A (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg