PDB entry 1j4a

View 1j4a on RCSB PDB site
Description: insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus
Deposited on 2001-08-18, released 2002-05-29
The last revision prior to the SCOP 1.63 freeze date was dated 2002-05-29, with a file datestamp of 2002-05-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j4aA (A:)
    tkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyiae
    tlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilrq
    dkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrnp
    elekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplvd
    tdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktafy
    tthavrnmvvkafdnnlelvegkeaetpvkv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j4aB (B:)
    tkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyiae
    tlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilrq
    dkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrnp
    elekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplvd
    tdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktafy
    tthavrnmvvkafdnnlelvegkeaetpvkv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j4aC (C:)
    tkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyiae
    tlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilrq
    dkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrnp
    elekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplvd
    tdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktafy
    tthavrnmvvkafdnnlelvegkeaetpvkv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j4aD (D:)
    tkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyiae
    tlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilrq
    dkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrnp
    elekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplvd
    tdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtpktafy
    tthavrnmvvkafdnnlelvegkeaetpvkvg