PDB entry 1j3s

View 1j3s on RCSB PDB site
Description: Solution Structure of Reduced Recombinant Human Cytochrome c
Class: electron transport
Keywords: Ferrocytochrome c, ELECTRON TRANSPORT
Deposited on 2003-02-12, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j3sa_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j3sA (A:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne