PDB entry 1j3f

View 1j3f on RCSB PDB site
Description: Crystal Structure of an Artificial Metalloprotein:Cr(III)(3,3'-Me2-salophen)/apo-A71G Myoglobin
Class: oxygen storage/transport
Keywords: myoglobin, asymmetric catalysis, crystal, Schiff bases, chromium, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2003-01-24, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.194
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • initiating met (0)
      • engineered (71)
    Domains in SCOPe 2.06: d1j3fa_
  • Heterogens: CR, PO4, CZM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1j3fA (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

    Sequence, based on observed residues (ATOM records): (download) 
    >1j3fA (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkipikylefiseaiihvlhsrhpg
dfgadaqgamnkalelfrkdiaakykelgyqg