PDB entry 1j3b

View 1j3b on RCSB PDB site
Description: Crystal structure of ATP-dependent phosphoenolpyruvate carboxykinase from Thermus thermophilus HB8
Class: transferase
Keywords: phosphoenolpyruvate carboxykinase, adenosine triphosphate, Thermus thermophilus, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE
Deposited on 2003-01-21, released 2003-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent phosphoenolpyruvate carboxykinase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j3ba1, d1j3ba2
  • Chain 'B':
    Compound: ATP-dependent phosphoenolpyruvate carboxykinase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j3bb1, d1j3bb2
  • Heterogens: CA, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j3bA (A:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq
    rrlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgktt
    lstdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvv
    npesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarls
    peeamyyflsgytarvagtergvtepratfsacfgapflpmhpgvyarmlgekirkhapr
    vylvntgwtggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpq
    ellnpretwadkeaydqqarklarlfqenfqkyasgvakevaeagprte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3bA (A:)
    qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
    epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
    spwhalfarnmfilprrfgafvpgftvvhapyfqavperdgtrsevfvgisfqrrlvliv
    gtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgkttlstdper
    pligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvvnpesrrv
    qwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarlspeeamyy
    flsgytarvpratfsacfgapflpmhpgvyarmlgekirkhaprvylvntgwtggpygvg
    yrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpqellnpretwadkeayd
    qqarklarlfqenfqkyasgvakevaeagprte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j3bB (B:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq
    rrlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgktt
    lstdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvv
    npesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarls
    peeamyyflsgytarvagtergvtepratfsacfgapflpmhpgvyarmlgekirkhapr
    vylvntgwtggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpq
    ellnpretwadkeaydqqarklarlfqenfqkyasgvakevaeagprte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j3bB (B:)
    qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
    epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
    spwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfqr
    rlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgkttl
    stdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvvn
    pesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarlsp
    eeamyyflsgytarvpratfsacfgapflpmhpgvyarmlgekirkhaprvylvntgwtg
    gpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpqellnpretwa
    dkeaydqqarklarlfqenfqkyasgvakevaeagprt