PDB entry 1j30

View 1j30 on RCSB PDB site
Description: The crystal structure of sulerythrin, a rubrerythrin-like protein from a strictly aerobic and thermoacidiphilic archaeon
Class: electron transport
Keywords: rubrerythrin, sulerythrin, Sulfolobus tokodaii strain 7, four-helix bundle, domain swapping, metal binding site plasticity, STRUCTURAL GENOMICS
Deposited on 2003-01-16, released 2003-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 2003-10-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 144aa long hypothetical rubrerythrin
    Species: Sulfolobus tokodaii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1j30a_
  • Chain 'B':
    Compound: 144aa long hypothetical rubrerythrin
    Species: Sulfolobus tokodaii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1j30b_
  • Heterogens: FE, ZN, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j30A (A:)
    mkdlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafgh
    ldfirqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfe
    tlaraekshaekfqnvlkqlkggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j30A (A:)
    dlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafghld
    firqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfetl
    araekshaekfqnvlkqlkgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j30B (B:)
    mkdlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafgh
    ldfirqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfe
    tlaraekshaekfqnvlkqlkggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j30B (B:)
    dlkgtktaenlkqgfigesmanrrylyfakradeegypeiagllrsiaegetahafghld
    firqggltdpatdkpigtleqmiesaiagetyewtqmypgfakvareegfpevaewfetl
    araekshaekfqnvlkq