PDB entry 1j2q

View 1j2q on RCSB PDB site
Description: 20S proteasome in complex with calpain-Inhibitor I from archaeoglobus fulgidus
Class: hydrolase
Keywords: proteasome, ubiquitin, 20S, CP
Deposited on 2003-01-08, released 2003-03-18
The last revision prior to the SCOP 1.75 freeze date was dated 2003-03-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.241
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qa_
  • Chain 'B':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qb_
  • Chain 'C':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qc_
  • Chain 'D':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qd_
  • Chain 'E':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qe_
  • Chain 'F':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qf_
  • Chain 'G':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qg_
  • Chain 'H':
    Compound: Proteasome beta subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qh_
  • Chain 'I':
    Compound: Proteasome beta subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qi_
  • Chain 'J':
    Compound: Proteasome beta subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qj_
  • Chain 'K':
    Compound: Proteasome beta subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qk_
  • Chain 'L':
    Compound: Proteasome beta subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2ql_
  • Chain 'M':
    Compound: Proteasome beta subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qm_
  • Chain 'N':
    Compound: Proteasome beta subunit
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1j2qn_
  • Heterogens: CIB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qA (A:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qB (B:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qC (C:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qD (D:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qE (E:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qF (F:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qG (G:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qH (H:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qI (I:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qJ (J:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qK (K:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qL (L:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qM (M:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j2qN (N:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk