PDB entry 1j2p

View 1j2p on RCSB PDB site
Description: alpha-ring from the proteasome from archaeoglobus fulgidus
Class: hydrolase
Keywords: proteasome, alpha-ring, hydrolase
Deposited on 2003-01-08, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.257
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29760 (Start-232)
      • conflict (60)
      • conflict (104)
      • conflict (141)
      • conflict (168)
    Domains in SCOPe 2.07: d1j2pa_
  • Chain 'B':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29760 (Start-232)
      • conflict (60)
      • conflict (104)
      • conflict (141)
      • conflict (168)
    Domains in SCOPe 2.07: d1j2pb_
  • Chain 'C':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29760 (Start-232)
      • conflict (60)
      • conflict (104)
      • conflict (141)
      • conflict (168)
    Domains in SCOPe 2.07: d1j2pc_
  • Chain 'D':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29760 (Start-232)
      • conflict (60)
      • conflict (104)
      • conflict (141)
      • conflict (168)
    Domains in SCOPe 2.07: d1j2pd_
  • Chain 'E':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29760 (Start-232)
      • conflict (60)
      • conflict (104)
      • conflict (141)
      • conflict (168)
    Domains in SCOPe 2.07: d1j2pe_
  • Chain 'F':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29760 (Start-232)
      • conflict (60)
      • conflict (104)
      • conflict (141)
      • conflict (168)
    Domains in SCOPe 2.07: d1j2pf_
  • Chain 'G':
    Compound: Proteasome alpha subunit
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29760 (Start-232)
      • conflict (60)
      • conflict (104)
      • conflict (141)
      • conflict (168)
    Domains in SCOPe 2.07: d1j2pg_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j2pA (A:)
    mhlpqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklle
    kdtiekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfk
    qqytqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyr
    ddlsfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveraneri
    rellkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2pA (A:)
    pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt
    iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy
    tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl
    sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel
    lkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j2pB (B:)
    mhlpqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklle
    kdtiekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfk
    qqytqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyr
    ddlsfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveraneri
    rellkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2pB (B:)
    pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt
    iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy
    tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl
    sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel
    lkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j2pC (C:)
    mhlpqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklle
    kdtiekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfk
    qqytqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyr
    ddlsfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveraneri
    rellkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2pC (C:)
    pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt
    iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy
    tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl
    sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel
    lkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j2pD (D:)
    mhlpqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklle
    kdtiekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfk
    qqytqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyr
    ddlsfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveraneri
    rellkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2pD (D:)
    pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt
    iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy
    tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl
    sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel
    lkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1j2pE (E:)
    mhlpqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklle
    kdtiekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfk
    qqytqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyr
    ddlsfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveraneri
    rellkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2pE (E:)
    pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt
    iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy
    tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl
    sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel
    lkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1j2pF (F:)
    mhlpqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklle
    kdtiekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfk
    qqytqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyr
    ddlsfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveraneri
    rellkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2pF (F:)
    pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt
    iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy
    tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl
    sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel
    lkk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1j2pG (G:)
    mhlpqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklle
    kdtiekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfk
    qqytqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyr
    ddlsfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveraneri
    rellkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j2pG (G:)
    pqmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgskllekdt
    iekiykidehicaatsglvadarvlidrarieaqinrltydipitvkelakkicdfkqqy
    tqyggvrpfgvslliagvnevpklyetdpsgalleykataigmgrmavteffekeyrddl
    sfddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirel
    lkk