PDB entry 1j1c

View 1j1c on RCSB PDB site
Description: Binary complex structure of human tau protein kinase I with ADP
Class: transferase
Keywords: complex, tau, kinase, ADP, TRANSFERASE
Deposited on 2002-12-03, released 2003-12-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1j1ca_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1j1cb_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j1cA (A:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1cA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j1cB (B:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1cB (B:)
    fgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelv
    aikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrv
    arhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfg
    sakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsg
    vdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlle
    ytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilippha
    riqa