PDB entry 1j1b

View 1j1b on RCSB PDB site
Description: Binary complex structure of human tau protein kinase I with AMPPNP
Class: transferase
Keywords: complex, tau, kinase, AMPPNP, TRANSFERASE
Deposited on 2002-12-03, released 2003-12-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.216
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1j1ba_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1j1bb_
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j1bA (A:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1bA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j1bB (B:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j1bB (B:)
    fgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelv
    aikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrv
    arhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfg
    sakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsg
    vdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlle
    ytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilippha
    riqa