PDB entry 1j0g

View 1j0g on RCSB PDB site
Description: Solution Structure of Mouse Hypothetical 9.1 kDa Protein, A Ubiquitin-like Fold
Class: structural genomics, unknown function
Keywords: Hypothetical protein, Ubiquitin-like fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2002-11-13, released 2003-12-09
The last revision prior to the SCOP 1.73 freeze date was dated 2003-12-09, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical Protein 1810045K17
    Species: MUS MUSCULUS
    Gene: RIKEN cDNA 1810045K17
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61961 (7-91)
      • cloning artifact (0-6)
    Domains in SCOP 1.73: d1j0ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0gA (A:)
    gsegaatmskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitnd
    giginpaqtagnvflkhgselriiprdrvgsc