PDB entry 1j0e

View 1j0e on RCSB PDB site
Description: ACC deaminase mutant reacton intermediate
Class: lyase
Keywords: PLP dependent B group, LYASE
Deposited on 2002-11-12, released 2003-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.202
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Williopsis saturnus [TaxId:4906]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M523 (0-340)
      • engineered (0)
      • engineered (294)
    Domains in SCOPe 2.07: d1j0ea_
  • Chain 'B':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Williopsis saturnus [TaxId:4906]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M523 (0-340)
      • engineered (0)
      • engineered (294)
    Domains in SCOPe 2.07: d1j0eb_
  • Chain 'C':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Williopsis saturnus [TaxId:4906]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M523 (0-340)
      • engineered (0)
      • engineered (294)
    Domains in SCOPe 2.07: d1j0ec_
  • Chain 'D':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Williopsis saturnus [TaxId:4906]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7M523 (0-340)
      • engineered (0)
      • engineered (294)
    Domains in SCOPe 2.07: d1j0ed_
  • Heterogens: PLP, 1AC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0eA (A:)
    agvakfakypltfgpspisnlnrlsqhlgskvnvyakredcnsglafggnklrkleyivp
    divegdythlvsiggrqsnqtrmvaalaaklgkkcvliqedwvpipeaekdvynrvgnie
    lsrimgadvrviedgfdigmrksfanalqeledaghkpypipagcsehkygglgfvgfad
    evinqevelgikfdkivvccvtgsttagilagmaqygrqddviaidasftsektkeqtlr
    ianntakligvehefkdftldtrfaypcygvpnegtieairtcaeqegvltdpvfegksm
    qglialikedyfkpganvlyvhlggapalsayssffptkta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0eB (B:)
    agvakfakypltfgpspisnlnrlsqhlgskvnvyakredcnsglafggnklrkleyivp
    divegdythlvsiggrqsnqtrmvaalaaklgkkcvliqedwvpipeaekdvynrvgnie
    lsrimgadvrviedgfdigmrksfanalqeledaghkpypipagcsehkygglgfvgfad
    evinqevelgikfdkivvccvtgsttagilagmaqygrqddviaidasftsektkeqtlr
    ianntakligvehefkdftldtrfaypcygvpnegtieairtcaeqegvltdpvfegksm
    qglialikedyfkpganvlyvhlggapalsayssffptkta
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0eC (C:)
    agvakfakypltfgpspisnlnrlsqhlgskvnvyakredcnsglafggnklrkleyivp
    divegdythlvsiggrqsnqtrmvaalaaklgkkcvliqedwvpipeaekdvynrvgnie
    lsrimgadvrviedgfdigmrksfanalqeledaghkpypipagcsehkygglgfvgfad
    evinqevelgikfdkivvccvtgsttagilagmaqygrqddviaidasftsektkeqtlr
    ianntakligvehefkdftldtrfaypcygvpnegtieairtcaeqegvltdpvfegksm
    qglialikedyfkpganvlyvhlggapalsayssffptkta
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0eD (D:)
    agvakfakypltfgpspisnlnrlsqhlgskvnvyakredcnsglafggnklrkleyivp
    divegdythlvsiggrqsnqtrmvaalaaklgkkcvliqedwvpipeaekdvynrvgnie
    lsrimgadvrviedgfdigmrksfanalqeledaghkpypipagcsehkygglgfvgfad
    evinqevelgikfdkivvccvtgsttagilagmaqygrqddviaidasftsektkeqtlr
    ianntakligvehefkdftldtrfaypcygvpnegtieairtcaeqegvltdpvfegksm
    qglialikedyfkpganvlyvhlggapalsayssffptkta