PDB entry 1j0b

View 1j0b on RCSB PDB site
Description: Crystal Structure Analysis of the ACC deaminase homologue complexed with inhibitor
Deposited on 2002-11-12, released 2003-05-12
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-12, with a file datestamp of 2003-05-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.291
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1j0ba_
  • Chain 'B':
    Domains in SCOP 1.65: d1j0bb_
  • Chain 'C':
    Domains in SCOP 1.65: d1j0bc_
  • Chain 'D':
    Domains in SCOP 1.65: d1j0bd_
  • Chain 'E':
    Domains in SCOP 1.65: d1j0be_
  • Chain 'F':
    Domains in SCOP 1.65: d1j0bf_
  • Chain 'G':
    Domains in SCOP 1.65: d1j0bg_
  • Chain 'H':
    Domains in SCOP 1.65: d1j0bh_
  • Chain 'I':
    Domains in SCOP 1.65: d1j0bi_
  • Chain 'J':
    Domains in SCOP 1.65: d1j0bj_
  • Chain 'K':
    Domains in SCOP 1.65: d1j0bk_
  • Chain 'L':
    Domains in SCOP 1.65: d1j0bl_
  • Chain 'M':
    Domains in SCOP 1.65: d1j0bm_
  • Chain 'N':
    Domains in SCOP 1.65: d1j0bn_
  • Chain 'O':
    Domains in SCOP 1.65: d1j0bo_
  • Chain 'P':
    Domains in SCOP 1.65: d1j0bp_
  • Chain 'Q':
    Domains in SCOP 1.65: d1j0bq_
  • Chain 'R':
    Domains in SCOP 1.65: d1j0br_
  • Chain 'S':
    Domains in SCOP 1.65: d1j0bs_
  • Chain 'T':
    Domains in SCOP 1.65: d1j0bt_
  • Chain 'U':
    Domains in SCOP 1.65: d1j0bu_
  • Chain 'V':
    Domains in SCOP 1.65: d1j0bv_
  • Chain 'W':
    Domains in SCOP 1.65: d1j0bw_
  • Chain 'X':
    Domains in SCOP 1.65: d1j0bx_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bA (A:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bB (B:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bC (C:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bD (D:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bE (E:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bF (F:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bG (G:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bH (H:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bI (I:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bJ (J:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bK (K:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bL (L:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bM (M:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bN (N:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bO (O:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bP (P:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bQ (Q:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bR (R:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bS (S:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bT (T:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bU (U:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bV (V:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bW (W:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0bX (X:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll