PDB entry 1j0a

View 1j0a on RCSB PDB site
Description: Crystal Structure Analysis of the ACC deaminase homologue
Class: lyase
Keywords: PLP dependent, LYASE
Deposited on 2002-11-12, released 2003-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j0aa_
  • Chain 'B':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j0ab_
  • Chain 'C':
    Compound: 1-aminocyclopropane-1-carboxylate deaminase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j0ac_
  • Heterogens: SO4, PLP, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0aA (A:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0aB (B:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0aC (C:)
    mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
    llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
    etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
    kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
    kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
    ekilfihtggisgtfhygdkllsll